PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6BL_5A2DB8F78.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 327aa    MW: 36140.7 Da    PI: 5.3995
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6BL_5A2DB8F78.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.31.8e-181461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT eEd++l d+++++G g+W++ ++  g++R++k+c++rw +yl
  Traes_6BL_5A2DB8F78.1 14 KGPWTSEEDQKLTDYIEKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                           79********************************************97 PP

2Myb_DNA-binding58.51.5e-1867112148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg++T+eE++ +++++  lG++ W++Ia++++ gRt++++k++w+++l
  Traes_6BL_5A2DB8F78.1  67 RGKFTPEEEQTILQLHSVLGNK-WSAIAKHLP-GRTDNEIKNFWNTHL 112
                            89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.242961IPR017930Myb domain
SuperFamilySSF466897.99E-3311108IPR009057Homeodomain-like
SMARTSM007176.5E-151363IPR001005SANT/Myb domain
PfamPF002491.1E-161461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-251568IPR009057Homeodomain-like
CDDcd001675.56E-121661No hitNo description
PROSITE profilePS5129428.38762116IPR017930Myb domain
SMARTSM007177.6E-1866114IPR001005SANT/Myb domain
PfamPF002491.5E-1767112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-2969117IPR009057Homeodomain-like
CDDcd001676.65E-1469112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTSE EDQKLTDYIE KHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF TPEEEQTILQ LHSVLGNKWS AIAKHLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHRPRT DFFAALPQLI ALANLRQLVE QRPCDDQSGS QLQANAVQAA KLEYLQCLLQ  180
SAAAIATSPS SSSINTMPTD LEQIGLLSPS QMSSLSSMSS PRIMEGVNGQ DLVSGQVPDI  240
QIPSSSFFEH EQAIINCTNK NSDYSANSGE GEKLLLLSED SLPPLADFPI CNLGDACSTS  300
SCEAVGNSTQ LPIWSDSFYD EFMSEFA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-31121162105C-Myb DNA-Binding Domain
1mse_C1e-31121162105C-Myb DNA-Binding Domain
1gv2_A1e-31121162105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570617.10.0PREDICTED: transcription factor MYB39-like
TrEMBLW5GJQ60.0W5GJQ6_WHEAT; Uncharacterized protein
STRINGMLOC_52134.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112637132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-103myb domain protein 93
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]